AMPK alpha 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49430-25ul

Product Code. 18615228

Description

AMPK alpha 1 Polyclonal antibody specifically detects AMPK alpha 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: AMPK alpha 1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: AMP -activate kinase alpha 1 subunit, AMP-activated protein kinase, catalytic, alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK, AMPK alpha 1,5'-AMP-activated protein kinase, catalytic alpha-1 chain, AMPK subunit alpha-1, AMPK1, AMPKa1, EC 2.7.11, EC 2.7.11.1, MGC33776, MGC57364, protein kinase, AMP-activated, alpha 1 catalytic subunit
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
• Quantity: 25 μL
• Research Discipline: Apoptosis, Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Signal Transduction, Translation Control
• Gene ID (Entrez): 5562
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified