missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMID Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£360.00 - £553.00
Specifications
| Antigen | AMID |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18397965
|
Novus Biologicals
NBP3-17800-25UL |
25 μg |
£360.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18375244
|
Novus Biologicals
NBP3-17800-100UL |
100 μg |
£553.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AMID Polyclonal antibody specifically detects AMID in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| AMID | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Tumor Suppressors | |
| PBS, pH 7.2, 40% glycerol | |
| 84883 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| AMID, apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death, apoptosis-inducing factor 2, Apoptosis-inducing factor homologous mitochondrion-associated inducer of death, apoptosis-inducing factor, mitochondrion-associated, 2, Apoptosis-inducing factor-like mitochondrion-associated inducer of death, DKFZp686L1298, FLJ14497, p53-responsive gene 3 protein, PRG3apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer ofdeath, RP11-367H5.2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: AGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title