AMID Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17800-25UL

Product Code. 18397965

Description

AMID Polyclonal antibody specifically detects AMID in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: AMID
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: AMID, apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death, apoptosis-inducing factor 2, Apoptosis-inducing factor homologous mitochondrion-associated inducer of death, apoptosis-inducing factor, mitochondrion-associated, 2, Apoptosis-inducing factor-like mitochondrion-associated inducer of death, DKFZp686L1298, FLJ14497, p53-responsive gene 3 protein, PRG3apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer ofdeath, RP11-367H5.2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTE
• Quantity: 25 μg
• Research Discipline: Apoptosis, Cancer, Tumor Suppressors
• Gene ID (Entrez): 84883
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified