missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMCase/CHIA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | AMCase/CHIA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AMCase/CHIA Polyclonal specifically detects AMCase/CHIA in Human samples. It is validated for Western Blot.Specifications
| AMCase/CHIA | |
| Polyclonal | |
| Rabbit | |
| acidic mammalian chitinase, AMCASE, CHIT2DKFZp313J1722, chitinase, acidic, EC 3.2.1.14, Lung-specific protein TSA1902, TSA1902AMCase | |
| CHIA | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 27159 | |
| Synthetic peptides corresponding to CHIA(chitinase, acidic) The peptide sequence was selected from the N terminal of CHIA. Peptide sequence MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title