AMCase/CHIA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58987

Product Code. 18244994

Description

AMCase/CHIA Polyclonal specifically detects AMCase/CHIA in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AMCase/CHIA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CHIA
• Immunogen: Synthetic peptides corresponding to CHIA(chitinase, acidic) The peptide sequence was selected from the N terminal of CHIA. Peptide sequence MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Bovine: 85%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: acidic mammalian chitinase, AMCASE, CHIT2DKFZp313J1722, chitinase, acidic, EC 3.2.1.14, Lung-specific protein TSA1902, TSA1902AMCase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27159
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.