ALS2CR12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-70405

Product Code. 18212834

Description

ALS2CR12 Polyclonal specifically detects ALS2CR12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ALS2CR12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: FLACC1
• Immunogen: Synthetic peptides corresponding to ALS2CR12(amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12) The peptide sequence was selected from the N terminal of ALS2CR12. Peptide sequence SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 130540
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12
• Host Species: Rabbit
• Molecular Weight of Antigen: 52 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.