missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALPPL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | ALPPL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
ALPPL2 Polyclonal specifically detects ALPPL2 in Human samples. It is validated for Western Blot.Specifications
| ALPPL2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| P10696 | |
| 251 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Embryonic Stem Cell Markers, Protein Phosphatase, Signal Transduction, Stem Cell Markers | |
| Alkaline phosphatase Nagao isozyme, alkaline phosphatase, placental-like, alkaline phosphatase, placental-like 2, ALP-1, ALPG, ALPPL, EC 3.1.3.1, GCAP, Germ cell alkaline phosphatase, Nagao isozyme, Placental alkaline phosphatase-like, placental-like alkaline phosphatase, PLAP-like, testicular and thymus alkaline phosphatase | |
| Synthetic peptides corresponding to ALPPL2(alkaline phosphatase, placental-like 2) The peptide sequence was selected from the N terminal of ALPPL2 (NP_112603). Peptide sequence MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title