missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALPPL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57946
This item is not returnable.
View return policy
Description
ALPPL2 Polyclonal specifically detects ALPPL2 in Human samples. It is validated for Western Blot.
Specifications
| ALPPL2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Alkaline phosphatase Nagao isozyme, alkaline phosphatase, placental-like, alkaline phosphatase, placental-like 2, ALP-1, ALPG, ALPPL, EC 3.1.3.1, GCAP, Germ cell alkaline phosphatase, Nagao isozyme, Placental alkaline phosphatase-like, placental-like alkaline phosphatase, PLAP-like, testicular and thymus alkaline phosphatase | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Mouse: 81%; Rat: 78%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P10696 | |
| ALPG | |
| Synthetic peptides corresponding to ALPPL2(alkaline phosphatase, placental-like 2) The peptide sequence was selected from the N terminal of ALPPL2 (NP_112603). Peptide sequence MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT. | |
| 100 μL | |
| Embryonic Stem Cell Markers, Protein Phosphatase, Signal Transduction, Stem Cell Markers | |
| 251 | |
| Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction