missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha-Galactosidase A/GLA Rabbit anti-Human, Mouse, Rat, Clone: 7G8T9, Novus Biologicals™
Rabbit Monoclonal Antibody
£167.00 - £405.00
Specifications
| Antigen | alpha-Galactosidase A/GLA |
|---|---|
| Clone | 7G8T9 |
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18383725
|
Novus Biologicals
NBP3-16563-20UL |
20 μg |
£167.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18329755
|
Novus Biologicals
NBP3-16563-100UL |
100 μg |
£405.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
alpha-Galactosidase A/GLA Monoclonal antibody specifically detects alpha-Galactosidase A/GLA in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| alpha-Galactosidase A/GLA | |
| Western Blot 1:500 - 1:2000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Agalsidase, agalsidase alfa, Alpha-D-galactosidase A, Alpha-D-galactoside galactohydrolase, alpha-D-galactoside galactohydrolase 1, alpha-gal A, alpha-galactosidase A, EC 3.2.1, EC 3.2.1.22, GALA, galactosidase, alpha, melibiase | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human alpha-Galactosidase A/GLA (GLA) (P06280). FMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 7G8T9 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 2717 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title