missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha-Galactosidase A/GLA Rabbit anti-Human, Mouse, Rat, Clone: 7G8T9, Novus Biologicals™
Shop All Bio Techne ProductsDescription
alpha-Galactosidase A/GLA Monoclonal antibody specifically detects alpha-Galactosidase A/GLA in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | alpha-Galactosidase A/GLA |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 7G8T9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Agalsidase, agalsidase alfa, Alpha-D-galactosidase A, Alpha-D-galactoside galactohydrolase, alpha-D-galactoside galactohydrolase 1, alpha-gal A, alpha-galactosidase A, EC 3.2.1, EC 3.2.1.22, GALA, galactosidase, alpha, melibiase |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human alpha-Galactosidase A/GLA (GLA) (P06280). FMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFG |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?