missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha 1B-Glycoprotein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | A1BG |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
alpha 1B-Glycoprotein Polyclonal specifically detects alpha 1B-Glycoprotein in Human samples. It is validated for Western Blot.Specifications
| A1BG | |
| Polyclonal | |
| Purified | |
| RUO | |
| P04217 | |
| 1 | |
| Synthetic peptides corresponding to A1BG(alpha-1-B glycoprotein) The peptide sequence was selected from the N terminal of A1BG (NP_570602). Peptide sequence ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG. | |
| Primary | |
| 54 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| A1B, ABG, alpha-1-B glycoproteinGAB, alpha-1B-glycoprotein, DKFZp686F0970, HYST2477 | |
| A1BG | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title