missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha 1 Mannosidase 1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37938-25ul
This item is not returnable.
View return policy
Description
alpha 1 Mannosidase 1A Polyclonal specifically detects alpha 1 Mannosidase 1A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| alpha 1 Mannosidase 1A | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P33908 | |
| MAN1A1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK | |
| 25 μL | |
| Golgi Apparatus Markers | |
| 4121 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Alpha-1,2-mannosidase IA, EC 3.2.1, EC 3.2.1.113, HUMM3, HUMM9, Man(9)-alpha-mannosidase, MAN9, Man9-mannosidase, Mannosidase alpha class 1A member 1, mannosidase, alpha, class 1A, member 1, mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, Processing alpha-1,2-mannosidase IA | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction