missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha 1 Mannosidase 1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £486.00
Specifications
| Antigen | alpha 1 Mannosidase 1A |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18034724
|
Novus Biologicals
NBP2-37938 |
0.1 mL |
£486.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607825
|
Novus Biologicals
NBP2-37938-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
alpha 1 Mannosidase 1A Polyclonal specifically detects alpha 1 Mannosidase 1A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| alpha 1 Mannosidase 1A | |
| Polyclonal | |
| Rabbit | |
| Golgi Apparatus Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Alpha-1,2-mannosidase IA, EC 3.2.1, EC 3.2.1.113, HUMM3, HUMM9, Man(9)-alpha-mannosidase, MAN9, Man9-mannosidase, Mannosidase alpha class 1A member 1, mannosidase, alpha, class 1A, member 1, mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, Processing alpha-1,2-mannosidase IA | |
| MAN1A1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P33908 | |
| 4121 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title