missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALKBH3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | ALKBH3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ALKBH3 Polyclonal specifically detects ALKBH3 in Human samples. It is validated for Western Blot.Specifications
| ALKBH3 | |
| Polyclonal | |
| Rabbit | |
| Q96Q83 | |
| 221120 | |
| Synthetic peptides corresponding to ALKBH3(alkB, alkylation repair homolog 3 (E. coli)) The peptide sequence was selected from the middle region of ALKBH3. Peptide sequence EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ABH3MGC118793, alkB, alkylation repair homolog 3 (E. coli), Alkylated DNA repair protein alkB homolog 3, DEPC1alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, DEPC-1MGC118792, EC 1.14.11, EC 1.14.11.-, FLJ43614, MGC118790, PCA1, Prostate cancer antigen 1, prostate cancer antigen-1 | |
| ALKBH3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title