ALKBH3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57586

Product Code. 18205013

Description

ALKBH3 Polyclonal specifically detects ALKBH3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ALKBH3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ABH3MGC118793, alkB, alkylation repair homolog 3 (E. coli), Alkylated DNA repair protein alkB homolog 3, DEPC1alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, DEPC-1MGC118792, EC 1.14.11, EC 1.14.11.-, FLJ43614, MGC118790, PCA1, Prostate cancer antigen 1, prostate cancer antigen-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Xenopus: 92%; Chicken: 92%; Canine: 92%; Guinea pig: 92%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96Q83
• Gene Symbols: ALKBH3
• Immunogen: Synthetic peptides corresponding to ALKBH3(alkB, alkylation repair homolog 3 (E. coli)) The peptide sequence was selected from the middle region of ALKBH3. Peptide sequence EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS.
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 221120
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.