ALG13 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92394-0.02ml

Product Code. 18643091

Description

ALG13 Polyclonal antibody specifically detects ALG13 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: ALG13
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: Asparagine-linked glycosylation 13 homolog, asparagine-linked glycosylation 13 homolog (S. cerevisiae), chromosome X open reading frame 45, CXorf45, EC 2.4.1.141, FLJ23018, FLJ31785, GLT28D1, glycosyltransferase 28 domain containing 1, Glycosyltransferase 28 domain-containing protein 1, hematopoietic stem/progenitor cells protein MDS031, MDS031, MGC12423, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, YGL047W
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-167 of human ALG13 (NP_001311219.1). VVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
• Quantity: 0.02 mL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79868
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG