missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aldo-keto Reductase 1B10/AKR1B10 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £359.00
Specifications
| Antigen | Aldo-keto Reductase 1B10/AKR1B10 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18383155
|
Novus Biologicals
NBP3-10841-25UL |
25 μg |
£161.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18318184
|
Novus Biologicals
NBP3-10841-100UL |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aldo-keto Reductase 1B10/AKR1B10 Polyclonal specifically detects Aldo-keto Reductase 1B10/AKR1B10 in Mouse samples. It is validated for Western Blot.Specifications
| Aldo-keto Reductase 1B10/AKR1B10 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Lipid and Metabolism | |
| PBS buffer, 2% sucrose | |
| 57016 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| AKR1B11, AKR1B12, aldo-keto reductase family 1 member B10, aldo-keto reductase family 1, member B10 (aldose reductase), aldo-keto reductase family 1, member B11 (aldose reductase-like), Aldose reductase-like, aldose reductase-like 1, aldose reductase-like peptide, Aldose reductase-related protein, ALDRLn, ARL1, ARL-1SI reductase, ARP, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.21, hARP, HIS, HSI, MGC14103, Small intestine reductase | |
| The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Aldo-keto Reductase 1B10/AKR1B10 (NP_032038.1). Peptide sequence TNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLED | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title