Aldo-keto Reductase 1B10/AKR1B10 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10841-100UL

Product Code. 18318184

Description

Aldo-keto Reductase 1B10/AKR1B10 Polyclonal specifically detects Aldo-keto Reductase 1B10/AKR1B10 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Aldo-keto Reductase 1B10/AKR1B10
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: AKR1B11, AKR1B12, aldo-keto reductase family 1 member B10, aldo-keto reductase family 1, member B10 (aldose reductase), aldo-keto reductase family 1, member B11 (aldose reductase-like), Aldose reductase-like, aldose reductase-like 1, aldose reductase-like peptide, Aldose reductase-related protein, ALDRLn, ARL1, ARL-1SI reductase, ARP, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.21, hARP, HIS, HSI, MGC14103, Small intestine reductase
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Aldo-keto Reductase 1B10/AKR1B10 (NP_032038.1). Peptide sequence TNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLED
• Quantity: 100 μg
• Research Discipline: Cancer, Lipid and Metabolism
• Gene ID (Entrez): 57016
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified