missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALDH9A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ALDH9A1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ALDH9A1 Polyclonal specifically detects ALDH9A1 in Human samples. It is validated for Western Blot.Specifications
| ALDH9A1 | |
| Polyclonal | |
| Rabbit | |
| B9EKV4 | |
| 223 | |
| Synthetic peptides corresponding to ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) The peptide sequence was selected from the C terminal of ALDH9A1. Peptide sequence MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| aldehyde dehydrogenase 9 family, member A1, Aldehyde dehydrogenase E3 isozyme, Aldehyde dehydrogenase family 9 member A1, ALDH4, ALDH7, ALDH9aldehyde dehydrogenase (NAD+), E34-trimethylaminobutyraldehyde dehydrogenase, EC 1.2.1, EC 1.2.1.19, EC 1.2.1.3, EC 1.2.1.47, EC 1.2.1.8, Gamma-aminobutyraldehyde dehydrogenase, R-aminobutyraldehyde dehydrogenase, TMABADH | |
| ALDH9A1 | |
| IgG | |
| 56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title