ALDH9A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69138

Product Code. 18263394

Description

ALDH9A1 Polyclonal specifically detects ALDH9A1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ALDH9A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: aldehyde dehydrogenase 9 family, member A1, Aldehyde dehydrogenase E3 isozyme, Aldehyde dehydrogenase family 9 member A1, ALDH4, ALDH7, ALDH9aldehyde dehydrogenase (NAD+), E34-trimethylaminobutyraldehyde dehydrogenase, EC 1.2.1, EC 1.2.1.19, EC 1.2.1.3, EC 1.2.1.47, EC 1.2.1.8, Gamma-aminobutyraldehyde dehydrogenase, R-aminobutyraldehyde dehydrogenase, TMABADH
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 86%; Bovine: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B9EKV4
• Gene Symbols: ALDH9A1
• Immunogen: Synthetic peptides corresponding to ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) The peptide sequence was selected from the C terminal of ALDH9A1. Peptide sequence MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 223
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.