missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AKR7A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56768
This item is not returnable.
View return policy
Description
AKR7A3 Polyclonal specifically detects AKR7A3 in Human samples. It is validated for Western Blot.
Specifications
| AKR7A3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| AFAR2, AFB1 aldehyde reductase 2, AFB1-AR 2, aflatoxin B1 aldehyde reductase 2, aflatoxin B1 aldehyde reductase member 3, aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase) | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 22977 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O95154 | |
| AKR7A3 | |
| Synthetic peptides corresponding to AKR7A3(aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase)) The peptide sequence was selected from the middle region of AKR7A3. Peptide sequence VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Guinea pig: 92%; Bovine: 85%; Equine: 78%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction