missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AKD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | AKD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AKD1 Polyclonal specifically detects AKD1 in Human samples. It is validated for Western Blot.Specifications
| AKD1 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| adenylate kinase domain containing 1, adenylate kinase domain containing 2, adenylate kinase domain-containing protein 1, Adenylate kinase domain-containing protein 2, AKD2, C6orf199, C6orf224, chromosome 6 open reading frame 199, chromosome 6 open reading frame 224, dJ70A9.1, FLJ16163, FLJ25791, FLJ34784, FLJ42177, MGC126763, MGC138153, MGC177059, MGC180194, MGC184281, MGC26954, RP1-70A9.1 | |
| Synthetic peptides corresponding to C6ORF199 The peptide sequence was selected from the N terminal of C6ORF199. Peptide sequence TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5TCS8 | |
| 221264 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title