AKD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56791

Product Code. 18251554

Description

AKD1 Polyclonal specifically detects AKD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AKD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: adenylate kinase domain containing 1, adenylate kinase domain containing 2, adenylate kinase domain-containing protein 1, Adenylate kinase domain-containing protein 2, AKD2, C6orf199, C6orf224, chromosome 6 open reading frame 199, chromosome 6 open reading frame 224, dJ70A9.1, FLJ16163, FLJ25791, FLJ34784, FLJ42177, MGC126763, MGC138153, MGC177059, MGC180194, MGC184281, MGC26954, RP1-70A9.1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Western clawed frog: 100%; Crab-eating macaque: 100%; Human: 100%; Chicken: 83%; Canine: 81%; Klebsiella sp. 1_1_55: 75%;.
• Target Species: Human, Mouse, Rat, Pig, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5TCS8
• Gene Symbols: AK9
• Immunogen: Synthetic peptides corresponding to C6ORF199 The peptide sequence was selected from the N terminal of C6ORF199. Peptide sequence TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 221264
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.