missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AGTPBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | AGTPBP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AGTPBP1 Polyclonal specifically detects AGTPBP1 in Human samples. It is validated for Western Blot.Specifications
| AGTPBP1 | |
| Polyclonal | |
| Rabbit | |
| Q9UPW5 | |
| 23287 | |
| Synthetic peptide directed towards the N terminal of human AGTPBP1The immunogen for this antibody is AGTPBP1 (NP_056054). Peptide Sequence: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ATP/GTP binding protein 1, ATP/GTP-binding protein 1, CCP1, DKFZp686M20191, EC 3.4.17, EC 3.4.17.-, KIAA1035NNA1cytosolic carboxypeptidase 1, Nervous system nuclear protein induced by axotomy protein 1 homolog, Nna1 | |
| AGTPBP1 | |
| IgG | |
| 134 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title