missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AGTPBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79579
This item is not returnable.
View return policy
Description
AGTPBP1 Polyclonal specifically detects AGTPBP1 in Human samples. It is validated for Western Blot.
Specifications
| AGTPBP1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ATP/GTP binding protein 1, ATP/GTP-binding protein 1, CCP1, DKFZp686M20191, EC 3.4.17, EC 3.4.17.-, KIAA1035NNA1cytosolic carboxypeptidase 1, Nervous system nuclear protein induced by axotomy protein 1 homolog, Nna1 | |
| Rabbit | |
| 134 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Zebrafish: 86%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UPW5 | |
| AGTPBP1 | |
| Synthetic peptide directed towards the N terminal of human AGTPBP1The immunogen for this antibody is AGTPBP1 (NP_056054). Peptide Sequence: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI | |
| Affinity purified | |
| RUO | |
| 23287 | |
| Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction