missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Adenylate Kinase 6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | Adenylate Kinase 6 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18266745
|
Novus Biologicals
NBP2-56093 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635298
|
Novus Biologicals
NBP2-56093-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Adenylate Kinase 6 Polyclonal specifically detects Adenylate Kinase 6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Adenylate Kinase 6 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AD-004, Adenylate kinase isoenzyme 6, adrenal gland protein AD-004, AK/ATPase, AK6, ATP-AMP transphosphorylase 6, CGI-137, CINAP, CIP, coilin interacting nuclear ATPase protein, coilin interacting protein, Coilin-interacting nuclear ATPase protein, Dual activity adenylate kinase/ATPase, EC=2.7.4.3, hCINAP | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| AK6 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title