Adenylate Kinase 6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56093-25ul

Product Code. 18635298

Description

Adenylate Kinase 6 Polyclonal specifically detects Adenylate Kinase 6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Adenylate Kinase 6
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: AD-004, Adenylate kinase isoenzyme 6, adrenal gland protein AD-004, AK/ATPase, AK6, ATP-AMP transphosphorylase 6, CGI-137, CINAP, CIP, coilin interacting nuclear ATPase protein, coilin interacting protein, Coilin-interacting nuclear ATPase protein, Dual activity adenylate kinase/ATPase, EC=2.7.4.3, hCINAP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AK6
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

For Research Use Only