Adenylate Cyclase 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-90281-25ul

Product Code. 18481982

Description

Adenylate Cyclase 2 Polyclonal specifically detects Adenylate Cyclase 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Adenylate Cyclase 2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: 3'-5'-cyclic AMP synthetase, AC2, adenylate cyclase 2 (brain), adenylate cyclase II, adenylate cyclase type 2, Adenylate cyclase type II, Adenylyl cyclase 2, ATP pyrophosphate-lyase 2, EC 4.6.1.1, FLJ45092, HBAC2, KIAA1060FLJ16822, MGC133314, type II adenylate cyclase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ADCY2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATA
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 108
• Target Species: Human
• Isotype: IgG

For Research Use Only