ADAMTS19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69170

Product Code. 18297331

Description

ADAMTS19 Polyclonal specifically detects ADAMTS19 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ADAMTS19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: A disintegrin and metalloproteinase with thrombospondin motifs 19, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 19, ADAM metallopeptidase with thrombospondin type 1 motif, 19, ADAM-TS 19, ADAM-TS19, ADAMTS-19, EC 3.4.24.-, FLJ16042
• Host Species: Rabbit
• Molecular Weight of Antigen: 100 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Rat: 77%.
• Target Species: Human, Rat, Bovine, Canine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TE59
• Gene Symbols: ADAMTS19
• Immunogen: Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 171019
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.