missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM33 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ADAM33 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADAM33 Polyclonal specifically detects ADAM33 in Human samples. It is validated for Western Blot.Specifications
| ADAM33 | |
| Polyclonal | |
| Rabbit | |
| Asthma, Cell Cycle and Replication, Immunology | |
| a disintegrin and metalloprotease 33, a disintegrin and metalloproteinase domain 33, ADAM 33, ADAM metallopeptidase domain 33, C20orf153, chromosome 20 open reading frame 153, disintegrin and metalloproteinase domain-containing protein 33, disintegrin and reprolysin metalloproteinase family protein, DJ964F7.1, DKFZp434K0521, EC 3.4.24.-, FLJ35308, FLJ36751, MGC149823, MGC71889 | |
| ADAM33 | |
| IgG | |
| 62 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BZ11 | |
| 80332 | |
| Synthetic peptides corresponding to ADAM33(ADAM metallopeptidase domain 33) The peptide sequence was selected from the middle region of ADAM33 (NP_079496). Peptide sequence HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title