missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM33 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59046
This item is not returnable.
View return policy
Description
ADAM33 Polyclonal specifically detects ADAM33 in Human samples. It is validated for Western Blot.
Specifications
| ADAM33 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| a disintegrin and metalloprotease 33, a disintegrin and metalloproteinase domain 33, ADAM 33, ADAM metallopeptidase domain 33, C20orf153, chromosome 20 open reading frame 153, disintegrin and metalloproteinase domain-containing protein 33, disintegrin and reprolysin metalloproteinase family protein, DJ964F7.1, DKFZp434K0521, EC 3.4.24.-, FLJ35308, FLJ36751, MGC149823, MGC71889 | |
| Rabbit | |
| 62 kDa | |
| 100 μL | |
| Asthma, Cell Cycle and Replication, Immunology | |
| 80332 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9BZ11 | |
| ADAM33 | |
| Synthetic peptides corresponding to ADAM33(ADAM metallopeptidase domain 33) The peptide sequence was selected from the middle region of ADAM33 (NP_079496). Peptide sequence HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Rabbit: 92%; Xenopus: 84%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction