missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ADAM30 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADAM30 Polyclonal specifically detects ADAM30 in Human samples. It is validated for Western Blot.Specifications
| ADAM30 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| a disintegrin and metalloproteinase domain 30, ADAM 30, ADAM metallopeptidase domain 30, disintegrin and metalloproteinase domain-containing protein 30, EC 3.4.24.-, svph4 | |
| ADAM30 | |
| IgG | |
| 66 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UKF2 | |
| 11085 | |
| Synthetic peptides corresponding to ADAM30(ADAM metallopeptidase domain 30) The peptide sequence was selected from the N terminal of ADAM30. Peptide sequence IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title