missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62430
This item is not returnable.
View return policy
Description
ADAM30 Polyclonal specifically detects ADAM30 in Human samples. It is validated for Western Blot.
Specifications
| ADAM30 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| a disintegrin and metalloproteinase domain 30, ADAM 30, ADAM metallopeptidase domain 30, disintegrin and metalloproteinase domain-containing protein 30, EC 3.4.24.-, svph4 | |
| Rabbit | |
| 66 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UKF2 | |
| ADAM30 | |
| Synthetic peptides corresponding to ADAM30(ADAM metallopeptidase domain 30) The peptide sequence was selected from the N terminal of ADAM30. Peptide sequence IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH. | |
| Affinity purified | |
| RUO | |
| 11085 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction