missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ADAM22 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADAM22 Polyclonal specifically detects ADAM22 in Mouse samples. It is validated for Western Blot.Specifications
| ADAM22 | |
| Polyclonal | |
| Rabbit | |
| Q9R1V6 | |
| 53616 | |
| Synthetic peptides corresponding to Adam22 (a disintegrin and metallopeptidase domain 22) The peptide sequence was selected from the N terminal of mouse Adam22 (NP_001007222). Peptide sequence AISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGIC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ADAM 22, ADAM metallopeptidase domain 22, metalloproteinase-disintegrin ADAM22-3, metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2, MGC149832 | |
| ADAM22 | |
| IgG | |
| 91 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title