ADAM22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69015

Product Code. 18281022

Description

ADAM22 Polyclonal specifically detects ADAM22 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ADAM22
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADAM 22, ADAM metallopeptidase domain 22, metalloproteinase-disintegrin ADAM22-3, metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2, MGC149832
• Host Species: Rabbit
• Molecular Weight of Antigen: 91 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9R1V6
• Gene Symbols: ADAM22
• Immunogen: Synthetic peptides corresponding to Adam22 (a disintegrin and metallopeptidase domain 22) The peptide sequence was selected from the N terminal of mouse Adam22 (NP_001007222). Peptide sequence AISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGIC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 53616
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG