missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ADAM2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADAM2 Polyclonal specifically detects ADAM2 in Human samples. It is validated for Western Blot.Specifications
| ADAM2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ADAM metallopeptidase domain 2, Cancer/testis antigen 15, CRYN2, CT15ADAM 2, disintegrin and metalloproteinase domain-containing protein 2, EC 3.4.24, fertilin beta, Fertilin subunit beta, FTNBCRYN1, PH-30, PH-30b, PH30PH30-beta | |
| ADAM2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q99965 | |
| 2515 | |
| Synthetic peptides corresponding to ADAM2(ADAM metallopeptidase domain 2 (fertilin beta)) The peptide sequence was selected from the middle region of ADAM2. Peptide sequence PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title