ADAM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59224

Product Code. 18213753

Description

ADAM2 Polyclonal specifically detects ADAM2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ADAM2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADAM metallopeptidase domain 2, Cancer/testis antigen 15, CRYN2, CT15ADAM 2, disintegrin and metalloproteinase domain-containing protein 2, EC 3.4.24, fertilin beta, Fertilin subunit beta, FTNBCRYN1, PH-30, PH-30b, PH30PH30-beta
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2515
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q99965
• Gene Symbols: ADAM2
• Immunogen: Synthetic peptides corresponding to ADAM2(ADAM metallopeptidase domain 2 (fertilin beta)) The peptide sequence was selected from the middle region of ADAM2. Peptide sequence PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG