missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADA2a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ADA2a |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADA2a Polyclonal specifically detects ADA2a in Human samples. It is validated for Western Blot.Specifications
| ADA2a | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, mTOR Pathway | |
| NP_001479 | |
| 6871 | |
| Synthetic peptide directed towards the C terminal of human TADA2L. Peptide sequence RRQADIDSGLSPSIPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| ADA2AFLJ12705, ADA2-like protein, hADA2, TADA2LADA2, transcriptional adapter 2-alpha, Transcriptional adapter 2-like, transcriptional adaptor 2 (ADA2 homolog, yeast)-like, transcriptional adaptor 2 alpha, transcriptional adaptor 2A | |
| TADA2A | |
| IgG | |
| 51 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title