missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACTR3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ACTR3B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACTR3B Polyclonal specifically detects ACTR3B in Human samples. It is validated for Western Blot.Specifications
| ACTR3B | |
| Polyclonal | |
| Rabbit | |
| Q9P1U1 | |
| 57180 | |
| Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B. Peptide sequence MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| actin-related protein 3B, actin-related protein 3-beta, actin-related protein Arp11, Actin-related protein ARP4, ARP11Actin-like protein 3B, ARP3 actin-related protein 3 homolog B (yeast), ARP3beta, ARP3-beta, ARP4, DKFZp686O24114 | |
| ACTR3B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title