missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACTR10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ACTR10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACTR10 Polyclonal specifically detects ACTR10 in Human samples. It is validated for Western Blot.Specifications
| ACTR10 | |
| Polyclonal | |
| Rabbit | |
| Q9NZ32 | |
| 55860 | |
| Synthetic peptides corresponding to ACTR10(actin-related protein 10 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ACTR10 (NP_060947). Peptide sequence SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| actin-related protein 10 homolog (S. cerevisiae), Actin-related protein 11, ACTR11actin-related protein 10, Arp11, HARP11 | |
| ACTR10 | |
| IgG | |
| 46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title