missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACSM3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ACSM3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACSM3 Polyclonal specifically detects ACSM3 in Human samples. It is validated for Western Blot.Specifications
| ACSM3 | |
| Polyclonal | |
| Rabbit | |
| Q53FZ2 | |
| 6296 | |
| Synthetic peptides corresponding to thetase medium chain family member 3 Antibody against the C terminal of ACSM3. Immunizing peptide sequence DQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| acyl-CoA synthetase medium-chain family member 3Protein SA homolog, acyl-coenzyme A synthetase ACSM3, mitochondrial, Butyrate--CoA ligase 3, Butyryl-coenzyme A synthetase 3, EC 6.2.1, Middle-chain acyl-CoA synthetase 3, SA, SA (rat hypertension-associated) homolog, SA hypertension-associated homolog, SA hypertension-associated homolog (rat), SAH, SAHEC 6.2.1.2 | |
| ACSM3 | |
| IgG | |
| 66 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title