ACSM3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74081

Product Code. 18205334

Description

ACSM3 Polyclonal specifically detects ACSM3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ACSM3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: acyl-CoA synthetase medium-chain family member 3Protein SA homolog, acyl-coenzyme A synthetase ACSM3, mitochondrial, Butyrate--CoA ligase 3, Butyryl-coenzyme A synthetase 3, EC 6.2.1, Middle-chain acyl-CoA synthetase 3, SA, SA (rat hypertension-associated) homolog, SA hypertension-associated homolog, SA hypertension-associated homolog (rat), SAH, SAHEC 6.2.1.2
• Host Species: Rabbit
• Molecular Weight of Antigen: 66 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 78%; Rat: 86%; Zebrafish: 79%; Guinea pig: 79% .
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53FZ2
• Gene Symbols: ACSM3
• Immunogen: Synthetic peptides corresponding to thetase medium chain family member 3 Antibody against the C terminal of ACSM3. Immunizing peptide sequence DQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEW.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6296
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.