missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACOX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | ACOX2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18234141
|
Novus Biologicals
NBP2-57292 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607926
|
Novus Biologicals
NBP2-57292-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACOX2 Polyclonal specifically detects ACOX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ACOX2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase, 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase, 3-alpha, 7-alpha, acyl-CoA oxidase 2, branched chain, acyl-Coenzyme A oxidase 2, branched chain, BCOX, BRCACOXTHCA-CoA oxidase, BRCOX, EC 1.17.99.3, peroxisomal acyl-coenzyme A oxidase 2,3-alpha, peroxisomal branched chain acyl-CoA oxidase, THCCox, Trihydroxycoprostanoyl-CoA oxidase | |
| ACOX2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8309 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title