ACOX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57292-25ul

Product Code. 18607926

Description

ACOX2 Polyclonal specifically detects ACOX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ACOX2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase, 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase, 3-alpha, 7-alpha, acyl-CoA oxidase 2, branched chain, acyl-Coenzyme A oxidase 2, branched chain, BCOX, BRCACOXTHCA-CoA oxidase, BRCOX, EC 1.17.99.3, peroxisomal acyl-coenzyme A oxidase 2,3-alpha, peroxisomal branched chain acyl-CoA oxidase, THCCox, Trihydroxycoprostanoyl-CoA oxidase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8309
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ACOX2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only