ACE-2 Antibody (CL4013), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-59036-25ul

Code produit. 18608156

Description

ACE-2 Monoclonal specifically detects ACE-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécification

• Antigen: ACE-2
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:10000 - 1:20000, Immunohistochemistry-Paraffin 1:10000 - 1:20000
• Gene Alias: ACEHangiotensin I converting enzyme 2, ACE-related carboxypeptidase, angiotensin I converting enzyme (peptidyl-dipeptidase A) 2, angiotensin-converting enzyme 2, Angiotensin-converting enzyme homolog, DKFZp434A014, EC 3.4.17, EC 3.4.17.23, Metalloprotease MPROT15
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG1

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ACE2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
• Quantity: 25 μL
• Research Discipline: Immunology, Virology Bacteria and Parasites
• Gene ID (Entrez): 59272
• Target Species: Human
• Form: Purified

For Research Use Only