ABCG4 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92174-0.1ml

Product Code. 18605011

Description

ABCG4 Polyclonal antibody specifically detects ABCG4 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: ABCG4
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: ATP-binding cassette, sub-family G (WHITE), member 4, ATP-binding cassette, subfamily G, member 4, putative ABC transporter, WHITE2ATP-binding cassette sub-family G member 4
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human ABCG4 (NP_071452.2). KLYILSQGQCIFKGVVTNLIPYLKGLGLHCPTYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATST
• Quantity: 0.1 mL
• Research Discipline: ABC Transporters, Lipid and Metabolism
• Gene ID (Entrez): 64137
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified