missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | ABCG1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18265640
|
Novus Biologicals
NBP2-54681 |
100 μL |
£435.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18636946
|
Novus Biologicals
NBP2-54681-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ABCG1 Polyclonal specifically detects ABCG1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ABCG1 | |
| Polyclonal | |
| Rabbit | |
| ABC Transporters, Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9619 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| ABC transporter 8, ABC8ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette, sub-family G (WHITE), member 1, homolog of Drosophila white, MGC34313, White protein homolog, white protein homolog (ATP-binding cassette transporter 8), 10ATP-binding cassette transporter member 1 of subfamily G, WHITE1, WHT1 | |
| ABCG1 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title