missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54681
This item is not returnable.
View return policy
Description
ABCG1 Polyclonal specifically detects ABCG1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| ABCG1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
| ABC transporter 8, ABC8ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette, sub-family G (WHITE), member 1, homolog of Drosophila white, MGC34313, White protein homolog, white protein homolog (ATP-binding cassette transporter 8), 10ATP-binding cassette transporter member 1 of subfamily G, WHITE1, WHT1 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ABCG1 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG | |
| 100 μL | |
| ABC Transporters, Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction | |
| 9619 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction