missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCC9 Antibody (S319A-14), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-22403-0.025mg
This item is not returnable.
View return policy
Description
ABCC9 Monoclonal specifically detects ABCC9 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.
Specifications
| ABCC9 | |
| Monoclonal | |
| 1 mg/mL | |
| Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500 | |
| ABC37, ATP-binding cassette, sub-family C (CFTR/MRP), member 9, CMD1OATP-binding cassette transporter sub-family C member 9, EC 3.6.3.44, FLJ36852, Sulfonylurea receptor 2, sulfonylurea receptor 2A, SUR2ATP-binding cassette sub-family C member 9 | |
| Mouse | |
| Protein G purified | |
| RUO | |
| 10060 | |
| Mouse | |
| Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| S319A-14 | |
| Unconjugated | |
| P70170 | |
| ABCC9 | |
| Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A | |
| 0.025 mg | |
| Primary | |
| Detects approx 120kDa. Does not cross-react with SUR2B. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG2a |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction