missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCC9 Antibody (S319A-14), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
£181.00
Specifications
| Antigen | ABCC9 |
|---|---|
| Clone | S319A-14 |
| Concentration | 1 mg/mL |
| Dilution | Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
Description
ABCC9 Monoclonal specifically detects ABCC9 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
| ABCC9 | |
| 1 mg/mL | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| Mouse | |
| Mouse | |
| ABC37, ATP-binding cassette, sub-family C (CFTR/MRP), member 9, CMD1OATP-binding cassette transporter sub-family C member 9, EC 3.6.3.44, FLJ36852, Sulfonylurea receptor 2, sulfonylurea receptor 2A, SUR2ATP-binding cassette sub-family C member 9 | |
| ABCC9 | |
| IgG2a | |
| Protein G purified | |
| Detects approx 120kDa. Does not cross-react with SUR2B. |
| S319A-14 | |
| Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500 | |
| Monoclonal | |
| Purified | |
| RUO | |
| P70170 | |
| 10060 | |
| Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title